This is a working overview of synthetic peptide, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2026-05-07. Anything still debated is marked as such rather than presented as settled.
TB-500 is a synthetic peptide whose sequence corresponds to a short fragment near the N-terminus of thymosin beta-4, a small protein present in most mammalian cells. The fragment is commonly cited as containing the actin-binding region of the parent molecule, which is why it appears in laboratory work on cell migration and tissue repair. Suppliers distribute it as a lyophilised powder intended for research use. Its identity is defined by amino acid sequence and by the presence of an acetyl group on the N-terminal residue.
Full-length thymosin beta-4 consists of roughly forty-three amino acids and ranks among the more abundant small proteins in the cytoplasm. The fragment is much shorter, so it cannot reproduce every function attributed to the intact molecule. In cell culture, short actin-binding motifs can interfere with filament dynamics and cell movement, but such observations come from controlled experiments rather than from whole-animal work. Whether a truncated fragment produces the same effects as the parent protein remains an open question.
Proposed activity centers on actin sequestration and on the movement of cells during repair processes. In cell culture and animal models, the fragment has been associated with migration, tube formation, and tissue remodeling. These observations are frequently described as preliminary, because most published work uses rodent or in vitro systems rather than controlled human trials. Whether the short fragment reproduces the effects of the full protein remains an open question, and the relationship between dose, route, and measured outcome is not well characterized.
The compound circulates in the literature as a research reagent rather than an approved therapeutic. Regulatory agencies in several countries have not authorized it for medical use, and sporting bodies list related thymosin beta-4 peptides among prohibited substances. Suppliers typically market it with a purity figure and a certificate of analysis, while peer-reviewed clinical reports remain sparse. Discussions therefore often separate laboratory findings from anecdotal reports, and reviewers tend to note the small size and methodological limits of the available studies.
| Property | Value | Notes |
|---|---|---|
| Generic designation | Synthetic thymosin beta-4 N-terminal fragment | Peptide nomenclature varies by supplier |
| Peptide length | Approximately 17 amino acid residues | Reported length sometimes differs between sources |
| N-terminal modification | Acetyl group | Affects mass and chromatographic behaviour |
| Compound class | Small synthetic peptide | Not a small-molecule drug |
| Common synonyms | TB4 fragment; thymosin beta-4 fragment | Naming is inconsistent in popular media |
Research interest in thymosin beta-4 fragments centres on actin sequestration, cell migration and tissue repair models. Most published work uses cultured cells or animal wound and cardiac preparations, and findings are generally described as preliminary. No fragment of this protein has been approved as a therapeutic product by major regulators. Reviews of the field note inconsistent dosing, delivery routes and outcome measures across studies, which complicates direct comparison. The material is best understood as a laboratory reagent with an active but unresolved research literature.
TB-500 is a catalogue name applied to a synthetic peptide related to thymosin beta-4, an actin-binding protein found in most mammalian cells. Suppliers do not use the label consistently: some describe it as the full 43-residue protein, others as a short fragment from the actin-binding region, and others as a related tetrapeptide. Because the name is commercial rather than chemical, two products sold under it may not contain the same molecule. This naming ambiguity is the first point to check in any description of the material.
The most frequently cited identity is a seven-residue fragment with the sequence LKKTETQ, taken from the actin-binding domain of the parent protein. A separate molecule, N-acetyl-seryl-aspartyl-lysyl-proline, often shortened to Ac-SDKP, derives from the same protein's N-terminal region and appears in overlapping literature. Reported molecular masses therefore differ between sources, and a mass value on its own does not establish which fragment is present. Confirmation requires a defined sequence rather than a single number.
Once in solution, short peptides are generally less stable than the dry powder, and repeated freeze-thaw cycles are a common cause of loss. Laboratory guidance usually calls for aliquoting on first dissolution and storing aliquots at -20 °C or below, away from light. Adsorption to plastic and glass surfaces can lower measured concentration, particularly at low concentrations, so container material and buffer choice can affect results. Visible cloudiness, colour change or unexpected precipitate is a signal to re-check the material.
Purity is normally assessed by reversed-phase HPLC, with the main peak reported as a percentage of total peak area, while identity is confirmed by mass spectrometry. Electrospray and MALDI-TOF instruments are both used, and the observed mass is compared with the value calculated from the stated sequence. Ion-exchange or size-exclusion methods appear where aggregation or charge variants are of interest. Water content, counter-ion content and residual trifluoroacetate from purification are separate variables that can shift the measured mass and should be weighed when reading a certificate of analysis.
==== Structure ==== Differently linked chains have specific effects on the protein to which they are attached, caused by differences in the conformations of the protein chains. K29-, K33-, K63- and M1-linked chains have a fairly linear conformation; they are known as open-conformation chains. K6-, K11-, and K48-linked chains form closed conformations. The ubiquitin molecules in open-conformation chains do not interact with each other, except for the covalent isopeptide bonds linking them together. In contrast, the closed conformation chains have interfaces with interacting residues. Altering the chain conformations exposes and conceals different parts of the ubiquitin protein, and the different linkages are recognized by proteins that are specific for the unique topologies that are intrinsic to the linkage. Proteins can specifically bind to ubiquitin via ubiquitin-binding domains (UBDs). The distances between individual ubiquitin units in chains differ between lysine 63- and 48-linked chains. The UBDs exploit this by having small spacers between ubiquitin-interacting motifs that bind lysine 48-linked chains (compact ubiquitin chains) and larger spacers for lysine 63-linked chains. The machinery involved in recognising polyubiquitin chains can also differentiate between K63-linked chains and M1-linked chains, demonstrated by the fact that the latter can induce proteasomal degradation of the substrate.
1911 – Marie Sklodowska-Curie – discovery of radium & polonium 1935 – Irène Joliot-Curie – artificial radioactivity 1964 – Dorothy Crowfoot Hodgkin – protein crystallography 2009 – Ada E. Yonath – structure & function of the ribosome 2018 – Frances Arnold – directed evolution to engineer enzymes 2020 – Emmanuelle Charpentier and Jennifer Doudna – for CRISPR gene editing 2022 - Carolyn R. Bertozzi - for bioorthogonal chemistry Eight women have won the Nobel Prize in Chemistry (listed above), awarded annually since 1901 by the Royal Swedish Academy of Sciences. Marie Curie was the first woman to receive the prize in 1911, which was her second Nobel Prize (she also won the prize in physics in 1903, along with Pierre Curie and Henri Becquerel – making her the only woman to be award two Nobel prizes). Her prize in chemistry was for her "discovery of the elements radium and polonium, by the isolation of radium and the study of the nature and compounds of this remarkable element." Irene Joliot-Curie, Marie's daughter, became the second woman to be awarded this prize in 1935 for her discovery of artificial radioactivity. Dorothy Hodgkin won the prize in 1964 for the development of protein crystallography. Among her significant discoveries are the structures of penicillin and vitamin B12. Forty five years later, Ada Yonath shared the prize with Venkatraman Ramakrishnan and Thomas A. Steitz for the study of the structure and function of the ribosome.
Government Official website Cherokee Nation Citizens At-Large The Cherokee Phoenix General information Cherokee Nation articles in the archive of the Chicago Tribune Cherokee Nation Businesses Cherokee Nation Fish and Wildlife Association Cherokee Nation Foundation Housing Authority of the Cherokee Nation
Capsaicin (8-methyl-N-vanillyl-6-nonenamide) (, commonly ) is a toxin that is the main active component of chili peppers and gives them their distinct pungent, "spicy" or "hot" taste. It is a potent irritant for mammals for which it produces a sensation of burning in any tissue with which it comes into contact. Capsaicin and several related amides (capsaicinoids) are produced as secondary metabolites by chili peppers, likely as deterrents against eating by mammals and against the growth of fungi. Pure capsaicin is a hydrophobic, highly pungent (i.e., spicy) crystalline solid.
Sources: en.wikipedia.org
== Production == BASF's recent success is characterized by a focus on creating resource efficient product lines after completely abandoning consumer products. This strategy was reflected in production by a re-focus towards integrated production sites. The largest such integrated production site is located in Ludwigshafen employing 33,000 people. Integrated production sites are characterized by co-location of many individual production lines (producing a specific chemical), which share an interconnected material flow. Piping is used ubiquitously for volume materials. All production lines use common raw material sourcing and feed back waste resources, which can be used elsewhere (e.g. steam of various temperatures, sulfuric acid, carbon monoxide). The economic incentive for this approach is high resource and energy efficiency of the overall process, reduced shipping cost and associated reduced risk of accidents. Due to the high cost of such an integrated production site, it establishes a high entry barrier for competitors trying to enter the market for volume chemicals. BASF built a new chemical complex in Dahej, Gujarat at a cost of $100 million. This facility has South Asia's first methylene diphenyl diisocyanate (MDI) splitter for processing crude MDI. BASF has 8 production facilities in India. BASF SE has succeeded in developing a semi-crystalline polyamide that allows light to pass through largely unhindered, known as Ultramid.
Many animals can learn behaviours by imitation, but ants may be the only group apart from mammals where interactive teaching has been observed. A knowledgeable forager of Temnothorax albipennis can lead a naïve nest-mate to newly discovered food by the process of tandem running. The follower obtains knowledge through its leading tutor. The leader is acutely sensitive to the progress of the follower and slows down when the follower lags and speeds up when the follower gets too close. Controlled experiments with colonies of Cerapachys biroi suggest that an individual may choose nest roles based on her previous experience. An entire generation of identical workers was divided into two groups whose outcome in food foraging was controlled. One group was continually rewarded with prey, while it was made certain that the other failed. As a result, members of the successful group intensified their foraging attempts while the unsuccessful group ventured out fewer and fewer times. A month later, the successful foragers continued in their role while the others had moved to specialise in brood care.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
The IDF traces its roots to Jewish paramilitary organizations in the New Yishuv, starting with the Second Aliyah (1904 to 1914). The first such organization was Bar-Giora, founded in September 1907. Bar-Giora was transformed into Hashomer in April 1909, which operated until the British Mandate of Palestine came into being in 1920. Hashomer was an elitist organization with narrow scope, and was mainly created to protect against criminal gangs seeking to steal property. The Zion Mule Corps and the Jewish Legion, both part of the British Army of World War I, further bolstered the Yishuv with military experience and manpower, forming the basis for later paramilitary forces. After the 1920 Palestine riots against Jews in April 1920, the Yishuv leadership realised the need for a nationwide underground defense organization, and the Haganah was founded in June of the same year. The Haganah became a full-scale defense force after the 1936–1939 Arab revolt in Palestine with an organized structure, consisting of three main units—the Field Corps, Guard Corps, and the Palmach. During World War II, many Jews from the Yishuv enlisted in the British Armed Forces. Many of them served in the British Army, culminating in the formation of the Jewish Brigade. These would eventually form the backbone of the Israel Defense Forces, and provide it with its initial manpower and doctrine. Following Israel's Declaration of Independence, prime minister and defense minister David Ben-Gurion issued an order for the formation of the Israel Defense Forces on 26 May 1948.
== Prognosis == The prognosis for alpha thalassemia depends on the degree to which alpha globin production is affected. Those with mild alpha thalassemia, involving deletion of one or two alpha-globin genes, do not generally require treatment and have a normal life expectancy. Hemoglobin H disease, with three of the four genes either deleted or inactive, gives a mild to moderate form of anemia but may lead normal lives. The prognosis when all four genes are affected, leading to Hb Bart's hydrops fetalis, is very poor, with most affected fetuses dying in utero or shortly after birth due to severe fetal hypoxia. It can be treated with intrauterine transfusions, however survival remains low and the infant requires lifelong blood transfusions. As of 2017, 69 patients were known who have survived past infancy.
Sources: en.wikipedia.org
It is a synthetic peptide based on a short sequence near the start of thymosin beta-4. It is supplied as a research chemical rather than as a licensed pharmaceutical product.
No. Thymosin beta-4 is the full-length protein of about forty-three amino acids, while the fragment covers only its beginning. The two are related but are not interchangeable in experimental or analytical terms.
The label is a catalogue designation that became common in non-technical discussion. Scientific papers usually refer to the fragment by sequence or as a thymosin beta-4 N-terminal peptide.
TB-500 is a name used for a short synthetic peptide fragment taken from the actin-binding region of thymosin beta-4. Material sold under this label is usually a lyophilized powder supplied for laboratory research rather than a licensed medicine. The commonly cited sequence is LKKTETQ.