This is a working overview of Ac-LKKTETQ, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2026-03-09. Anything still debated is marked as such rather than presented as settled.
Dry powder is commonly held at minus twenty degrees Celsius, with some suppliers recommending lower temperatures for long-term archival storage. Once dissolved, solutions are typically kept cold and protected from light, since aqueous peptide solutions can lose integrity through hydrolysis or oxidation over time. Stability data specific to this fragment are limited in the public literature, and much of the guidance comes from general peptide handling practice rather than from controlled degradation studies. Users therefore treat stated shelf lives as approximate rather than fixed.
Identity and purity are normally assessed with reversed-phase high-performance liquid chromatography, paired with mass spectrometry to confirm molecular mass. A certificate of analysis reports a purity percentage, usually derived from chromatographic peak area, but that figure does not by itself prove a correct sequence or the absence of counterions. Independent verification may include amino acid analysis or peptide mapping. Batch-to-batch variation is a documented concern in the research chemical market, and the gap between a quoted purity value and actual peptide content can be substantial when the material is a salt or retains residual water.
Lyophilized peptide arrives as a dry cake that should stay sealed until use. Reconstitution is generally performed with sterile water or a buffered solution, and the resulting liquid should be handled gently to limit mechanical stress. Repeated freeze-thaw cycles are widely described as harmful to short peptides, so dividing a reconstituted batch into single-use portions is a common practice. Laboratories also record the solvent, concentration, and date of preparation on the vial label to keep later measurements traceable.
Regulatory status differs by country, but TB-500 is not an approved pharmaceutical in major jurisdictions. It is commonly sold as a research chemical for laboratory use, which places responsibility for identity and purity on the supplier and the laboratory. Published human data are limited, and most reports involve preclinical models or cell culture. Questions about whether the fragment mimics all actions of thymosin beta-4, and under which conditions, remain open. Independent verification of any material is therefore a practical requirement in research settings.
TB-500 is a synthetic heptapeptide with the sequence Ac-LKKTETQ. It corresponds to a short N-terminal region of thymosin beta-4, a 43-amino-acid protein found in many cell types. The fragment contains an actin-binding motif, which is one reason it appears in laboratory studies of cell migration and cytoskeletal dynamics. TB-500 is not the full-length protein and is produced as a research chemical rather than an approved therapeutic agent. Its molecular weight is approximately 889 Da.
| Property | Value | Notes |
|---|---|---|
| Molecular mass | Approximately 0.9 kDa | Depends on exact fragment sequence and counterion |
| Amino acid sequence | LKKTETQ (commonly cited) | Short actin-binding motif from thymosin beta-4 |
| Common salt form | Acetate salt | Trifluoroacetate also reported in research material |
| Reconstitution solvent | Sterile water or buffer | Gentle mixing; avoid vigorous agitation |
| Solution storage | -20 °C or lower | Aliquot to avoid repeated freeze-thaw cycles |
Dry peptide powder is commonly kept at −20 °C in a desiccated container away from light, a practice that limits moisture uptake and oxidation. Once dissolved, solutions are generally held at 2–8 °C for short periods or frozen at −20 °C or lower for longer storage, with repeated freeze-thaw cycles avoided. Hydrolysis and oxidation are the main degradation routes for peptides in solution, and both accelerate at higher temperature or extreme pH. Published stability data specific to TB-500 are limited, so shelf life should be treated as uncertain.
Identity and purity checks for peptide material typically combine reversed-phase high-performance liquid chromatography with mass measurement, since retention time alone cannot confirm a sequence. Mass measurement verifies the expected molecular mass within instrument tolerance, while chromatographic peak area provides a purity estimate. Anti-doping analysis of urine uses related but more sensitive workflows, sometimes after solid-phase extraction. For research material, batch documentation, certificate content, and independent testing are common points of scrutiny, because supply chains outside pharmaceutical regulation vary widely in the paperwork they provide.
Sports authorities classify the peptide as a prohibited substance, and it appears on the World Anti-Doping Agency list under peptide hormones, growth factors, and related substances. Racing jurisdictions for horses and dogs have issued separate restrictions, and several national bodies treat it as a controlled or prescription-only item. As a research chemical it is sold without a therapeutic indication, and labels usually state that the product is not for human or veterinary use. Regulatory treatment therefore varies by country.
Detection in biological matrices generally relies on liquid chromatography coupled with tandem mass spectrometry, because the peptide lacks a convenient ultraviolet chromophore beyond the amide backbone. Immunoassays have been described, but antibodies raised against the fragment can cross-react with the full-length protein or with unrelated peptides, so findings usually require confirmation by a second technique. Sample preparation typically involves protein precipitation followed by solid-phase extraction. Reported detection windows depend on dose, route, matrix, and instrument sensitivity.
Discussion of TB-500 appears in several distinct literatures that rarely cite one another. Peer-reviewed studies usually describe in vitro assays or small animal experiments and are cautious about extrapolation. Veterinary and sports communities circulate anecdotal reports with limited methodological detail. Commercial listings add a third layer, often using the name interchangeably with thymosin beta-4 even though the two molecules differ in size and sequence. Regulatory status varies by country, and the compound is not a licensed medicine in most jurisdictions, so readers comparing sources should check which molecule and which purity each source actually describes.
TB-500 is a synthetic seven-residue peptide whose sequence, LKKTETQ, matches the N-terminal actin-binding region of thymosin beta-4. It is usually supplied in an N-terminally acetylated form, a modification that blocks the free amino terminus and can influence behavior in solution. In the research literature the same sequence appears under several names, including thymosin beta-4 fragment and shortened thymosin beta-4. Because it is a short peptide rather than the full 43-residue parent protein, its measured properties differ from those reported for thymosin beta-4 as a whole, and the two are not interchangeable in experimental design.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography together with mass spectrometry. The chromatogram provides a purity estimate as a percentage of total peak area, while the mass spectrum confirms that the observed mass matches the expected value. Amino acid analysis or tandem mass spectrometry sequencing can provide additional confirmation. Reported purity figures depend on the column, gradient, and detection wavelength, so values from different laboratories are not directly comparable without method details.
Lyophilised peptide is normally reconstituted with sterile water or a neutral buffer shortly before use. Because repeated freeze-thaw cycles can degrade the material, dividing a reconstituted solution into single-use aliquots is a common practice. Working solutions are usually kept cold and protected from light. The exact shelf life depends on concentration, buffer composition, and handling, so it is often determined empirically rather than assumed.
Peptide bonds are susceptible to hydrolysis under extreme pH and to enzymatic cleavage if proteases are present. Heat, oxidising agents, and prolonged exposure to light also contribute to loss of material. Aggregation can occur at high concentrations or in certain buffer systems, and it may not be visible to the eye. Storage at -20 C or below is typical for both powder and aliquoted solutions, and desiccation of the powder is preferred.
Treatment of anorexia involves restoring the patient back to a healthy weight, treating their underlying psychological problems, and addressing underlying maladaptive behaviors, often with forms of talking therapy; some examples of clinically proven therapies include cognitive behavioral therapy or Maudsley family therapy, an approach where parents assume responsibility for feeding their child. A daily low dose of olanzapine has been shown to increase appetite and assist with some weight gain in patients. Psychiatrists may prescribe patients with anorexia nervosa forms of medication to better manage anxiety or depression, these being disorders often commonly associated with the disorder. However, medications are not considered a cure for anorexia nervosa: such pathways rather address underlying causes for the disorder, which often assist in recovery of it by allowing the individual to have a clearer and healthier mental state to understand the complications of anorexia nervosa. It does not assist those who do not have any other related mental conditions that affect their ability to do so. It has been proven to assist in the recovery of other eating disorders, such as bulimia nervosa and binge eating disorder. In severe cases, individuals may require to be fed by nasogastric tube to restore weight and healthy nutritional levels by force. Evidence for benefit from nasogastric tube feeding is unclear; some individuals recover after the first incident of admission, while others have recurring treatments over many years: sometimes indefinitely.
In a meeting of the Quadrilateral Security Dialogue on the implications of the 2022 Russian invasion of Ukraine for the region, President Biden noted India's abstention, saying that most global allies were united against Russia. Speaking to the US Senate Foreign Relations Committee, US diplomat Donald Lu said the Biden administration was still considering sanctions against India over its S-400 deal with Russia, and its abstention at the UN. However, the Biden administration has ruled out secondary sanctions against India for its considerable oil imports or defence engagement from Russia.
Leukocyte activation syndrome QT interval prolongation (only one case of torsades de pointes was noted during clinical trials) Atrial fibrillation or flutter Other side effects include allergic skin reactions (including reactions at the injection site, injection site pain), gastrointestinal disturbances (diarrhea), various types of pain, visual disturbances, and bleeding. If the drug extravasates, local irritation and phlebitis may occur.
Fibromodulin is a protein that in humans is encoded by the FMOD gene. Fibromodulin is a 42kDa protein of a family of small interstitial leucine-rich repeat proteoglycans (SLRPs). It can have up to four N-linked keratan sulfate chains attached to the core protein within the leucine-rich region. It shares significant sequence homology with biglycan and decorin.
Agouti signalling peptide adopts an inhibitor cystine knot motif. Along with the homologous Agouti-related peptide, these are the only known mammalian proteins to adopt this fold. The peptide consists of 131 amino acids. The lethal yellow mutation (Ay) was the first embryonic mutation to be characterized in mice, as homozygous lethal yellow mice (Ay/ Ay) die early in development, due to an error in trophectoderm differentiation. Lethal yellow homozygotes are rare today, while lethal yellow and viable yellow heterozygotes (Ay/a and Avy/a) remain more common. In wild-type mice agouti is only expressed in the skin during hair growth, but these dominant yellow mutations cause it to be expressed in other tissues as well. This ectopic expression of the agouti gene is associated with the yellow obese syndrome, characterized by early onset obesity, hyperinsulinemia and tumorigenesis.
Sources: en.wikipedia.org
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
In jaundice owing to hemolysis (prehepatic, or hemolytic, jaundice), the pathophysiology is that overproduction of bilirubin from the extravascular or intravascular hemolysis overwhelms the capacity of the liver to excrete it. The bilirubin present in the plasma is largely unconjugated in this setting as they haven't been taken up and conjugated by the liver. In this case, total serum bilirubin increases while the ratio of direct bilirubin to indirect bilirubin remains 96 to 4 as up to 96%-99% of bilirubin in the bile are conjugated mentioned above. Although there were some studies that showed an inverse correlation between serum bilirubin level and prevalences of ischemic coronary artery disease, cancer mortality, or colorectal cancer in general population, the potential benefits of the chemopreventive function of bilirubin and their causative relations haven't been proved.
CCL7 was first characterized from osteosarcoma supernatant. CCL7 consists of 99 amino acids, which contains 23-amino acid signal peptide. The mature protein about 76 amino acids is secreted after cleavage of the signal peptide. In contrast to most chemokines, CCL7 exists in a general monomeric form, differing from the dimer formed in a highly concentrated solution. CCL7 can exist in four different glycotypes with a molecular weight 11, 13, 17 and 18 kDa in COS cells. CCL7 mediates effects on the immune cell types through binding to numerous receptors, including CCR1, CCR2, CCR3, CCR5, and CCR10. These receptors belongs to the G protein-coupled seven-transmembrane receptors. CCL7 can also interact with cell surface glycosaminoglycans (GAGs) present on all animal cell surfaces.
100. Tirzepatide. Drugs and Lactation Database (LactMed®) [Internet]. Bethesda (MD): National Institute of Child Health and Human Development; 2006–. 2026 Aug 15. Tirzepatide is usually undetectable in breastmilk with subcutaneous doses of up to 5 mg. Furthermore, absorption by the infant is unlikely because it is probably partially destroyed in the infant’s gastrointestinal tract and poorly absorbed orally. If a mother requires tirzepatide, it is not a reason to discontinue breastfeeding. Until more data become available, tirzepatide should be used with caution during breastfeeding, especially while nursing a newborn or preterm infant. Some experts recommend closely monitoring of infant growth and developmental milestones and the nutritional status of the lactating woman.[1]
Sources: en.wikipedia.org
Dry lyophilized powder is usually kept frozen, desiccated, and out of direct light. Sealed vials are not opened until needed, because moisture uptake can degrade short peptides. Longer archival storage is often done at lower temperatures than routine working stock.
Reversed-phase liquid chromatography separates components and reports purity from peak area. Mass spectrometry confirms the molecular mass expected for the sequence. Additional approaches such as peptide mapping or amino acid analysis provide independent confirmation.
Reported percentages depend on the analytical method, the detection wavelength, and whether salts and water are counted. A value above ninety-five percent by chromatography does not by itself establish a correct sequence. Different suppliers also calculate purity against different reference standards.
TB-500 is a synthetic heptapeptide corresponding to a fragment of thymosin beta-4. It is used in laboratory research and is not an approved drug.