freeze-thaw is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2026-01-29. Where a claim depends on a specific study, the study is described rather than over-claimed.
Reconstitution practices affect downstream measurements. The dry powder is typically dissolved in sterile water or a suitable aqueous buffer, then mixed gently rather than vortexed at high speed. Visible particles or cloudiness suggest incomplete dissolution or contamination and should be investigated. For long-term storage, aliquots should be labeled with concentration, solvent, and date. Open questions include how different buffers alter peptide conformation and whether specific container materials adsorb the peptide. Those variables can change apparent concentration in assays even when the chemical identity is correct.
Lyophilized TB-500 is hygroscopic and should be kept dry before use. The usual storage recommendation for the solid is -20 °C, protected from light and moisture. Once dissolved, the peptide is less stable, and repeated freeze-thaw cycles can promote aggregation or degradation. Laboratories often divide a reconstituted solution into single-use aliquots and store them at -80 °C. Exact stability limits depend on buffer, pH, and concentration, so published data do not define a single universal condition.
Identity and purity are normally assessed with reversed-phase high-performance liquid chromatography, paired with mass spectrometry to confirm molecular mass. A certificate of analysis reports a purity percentage, usually derived from chromatographic peak area, but that figure does not by itself prove a correct sequence or the absence of counterions. Independent verification may include amino acid analysis or peptide mapping. Batch-to-batch variation is a documented concern in the research chemical market, and the gap between a quoted purity value and actual peptide content can be substantial when the material is a salt or retains residual water.
Lyophilized peptide arrives as a dry cake that should stay sealed until use. Reconstitution is generally performed with sterile water or a buffered solution, and the resulting liquid should be handled gently to limit mechanical stress. Repeated freeze-thaw cycles are widely described as harmful to short peptides, so dividing a reconstituted batch into single-use portions is a common practice. Laboratories also record the solvent, concentration, and date of preparation on the vial label to keep later measurements traceable.
| Property | Value | Notes |
|---|---|---|
| Storage temperature (dry) | -20 °C | Protected from light and moisture |
| Storage temperature (solution) | -80 °C | Single-use aliquots recommended |
| Identity assay | LC-MS or MALDI-TOF | Confirms mass near 889 Da |
| Purity assay | RP-HPLC | Reports main peak percentage |
| Common impurities | Truncated peptides, deamidated forms | Arise from synthesis or storage |
Identity and purity are assessed with a small set of standard techniques. Reverse-phase high-performance liquid chromatography gives a purity estimate from peak area, usually recorded at 214 or 220 nanometers, where the peptide bond absorbs. Mass spectrometry confirms the expected molecular mass and can reveal truncated or oxidized species. Amino acid analysis or tandem mass spectrometry sequencing can verify the sequence itself. Additional quality attributes include water content, residual trifluoroacetic acid carried over from purification, and endotoxin where the material is intended for biological work.
The compound is most often distributed as a lyophilized powder, appearing white to off-white and forming a loose cake or fluffy solid. It is hygroscopic to some degree, so brief exposure to humid air can add water weight and complicate weighing. The peptide dissolves readily in water and in neutral aqueous buffers, and aqueous solubility is generally described as high, well above the concentrations used in typical assays. Some polar organic solvents are also usable, which matters when a concentrated stock is prepared before dilution into buffer.
Storage recommendations center on keeping the dry powder cold, dry, and dark. A freezer at -20 degrees Celsius or below is conventional, and desiccant is often included to limit moisture uptake. Once dissolved, the peptide is less stable, and solutions are typically kept frozen and thawed only once. Repeated freeze-thaw cycles are a common source of losses because they promote aggregation and adsorption to container surfaces. Working aliquots are therefore prepared in advance, and glass or low-binding plastic is usually preferred over ordinary laboratory plastic.
Lyophilised material is stable for extended periods when kept dry and cold, and suppliers typically recommend storage well below freezing. Once dissolved, the peptide is handled at refrigeration temperatures and used within a short period, because peptide bonds and the acetylated terminus can be affected by repeated freeze-thaw cycles, proteases, or extreme pH. Bacteriostatic water and saline are both described as solvents, although preservatives can interfere with some analytical workflows. Reconstituted solutions are inspected for particulates before use.
Sports authorities classify the peptide as a prohibited substance, and it appears on the World Anti-Doping Agency list under peptide hormones, growth factors, and related substances. Racing jurisdictions for horses and dogs have issued separate restrictions, and several national bodies treat it as a controlled or prescription-only item. As a research chemical it is sold without a therapeutic indication, and labels usually state that the product is not for human or veterinary use. Regulatory treatment therefore varies by country.
Detection in biological matrices generally relies on liquid chromatography coupled with tandem mass spectrometry, because the peptide lacks a convenient ultraviolet chromophore beyond the amide backbone. Immunoassays have been described, but antibodies raised against the fragment can cross-react with the full-length protein or with unrelated peptides, so findings usually require confirmation by a second technique. Sample preparation typically involves protein precipitation followed by solid-phase extraction. Reported detection windows depend on dose, route, matrix, and instrument sensitivity.
TB-500 is a synthetic peptide preparation marketed under a name derived from thymosin beta-4, a 43-residue actin-binding protein first isolated from thymus tissue. The full-length protein has a reported molecular mass near 4963 Da, while material sold as TB-500 is often described as a fragment containing the actin-binding motif LKKTETQ. Because suppliers use the name inconsistently, published sources sometimes refer to the same label as a fragment, a synthetic copy, or a related analog. This naming ambiguity complicates direct comparison of reports across studies.
Laboratory work on thymosin beta-4 describes binding to monomeric actin and effects on cell migration, angiogenesis, and inflammatory signaling in cultured cells. Animal models have examined skin, corneal, and cardiac repair after injury, with outcomes reported mainly in preclinical literature. Most of that evidence concerns the parent protein rather than preparations labelled TB-500, so extrapolation from animal findings to a specific commercial product remains uncertain. Whether the two behave identically in living systems has not been established in controlled human studies.
Thymosin beta-4 itself is a natural peptide of 43 residues found in many cell types and body fluids. Its best-characterised function is binding and sequestering actin monomers, which influences cytoskeletal dynamics. The sequence most often associated with TB-500, LKKTETQ, corresponds to part of that actin-binding region. A different fragment, Ac-SDKP, is also derived from the same parent peptide and is studied in its own right, which is one reason discussions of thymosin fragments can become confusing. The two are structurally distinct and are not interchangeable.
Interest in the fragment grew during the 1990s and 2000s, when it moved from laboratory work into sports and supplement markets. Anti-doping bodies added thymosin beta-4 fragments to prohibited lists, and a small number of adverse analytical findings have been reported in competition testing. Published controlled human trials remain scarce. Most mechanistic evidence comes from cell culture and animal models, and those studies examine endpoints such as cell migration, wound closure and inflammation markers. That evidence supports research interest but does not establish clinical benefit, and broad regenerative claims should be read as unverified.
TB-500 is a short synthetic peptide sold under a trade name rather than a systematic chemical name. Suppliers usually describe it as a fragment of thymosin beta-4 and ship it as a lyophilised powder intended for laboratory use. Because the label is commercial, the exact sequence attributed to it is not fully consistent across catalogues, and some listings present a seven-residue peptide while others describe related fragments of similar length. It is not an approved medicine in any major jurisdiction, and it is handled as a research chemical.
== Further reading == Nakamoto, Satoshi (31 October 2008). "Bitcoin: A Peer-to-Peer Electronic Cash System" (PDF). bitcoin.org. Archived from the original (PDF) on 20 March 2014. Retrieved 28 April 2014.
=== LFA-1 and LFA-3–based therapeutics for autoimmune disease === Although Springer made the first antibodies to LFA-1 and LFA-3, he did not patent them. An antibody isolated by Hildreth and McMichael was licensed to Genentech, which was humanized and approved by the FDA in 2003 for moderate to severe psoriasis as Raptiva. Its generic name efalizumab simulate the letters F and L in LFA-1. Springer and lab member Mike Dustin collaborated with Barbara Wallner at Biogen to clone the cDNA for LFA-3. The LFA-3 ectodomain, which contains one immunoglobulin-like domain, was fused to the Fc domain of IgG to create Amevive. Amevive was approved for moderate to severe psoriasis in 2003. Its generic name, alefacept, is a homophone of LFA plus "cept" from receptor. Royalties paid by Biogen to Dana Farber Cancer Institute were equally shared by Dustin and Springer.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
MT-ND6 interacts with the NADH dehydrogenase [ubiquinone] iron-sulfur protein 3 (NDUFS3) and the ATP-dependent metalloprotease YME1L1. Mass spectrometry characterization of MT-ND6 at COPaKB GeneReviews/NCBI/NIH/UW entry on Mitochondrial DNA-Associated Leigh Syndrome and NARP This article incorporates text from the United States National Library of Medicine, which is in the public domain.
Beano is an enzyme-based dietary supplement that is used to reduce gas in the digestive tract, thereby improving digestion and reducing bloating, discomfort, and flatulence caused by gas. It contains the enzyme alpha-galactosidase (α-GAL). It was introduced as a liquid, but that has been discontinued and it is now available only as tablets and strawberry-flavored "Meltaways". Beano is marketed and distributed by Prestige Consumer Healthcare, Inc.
Sources: en.wikipedia.org
== Historical uses == Following its discovery by Marie and Pierre Curie in 1898, radium (principally 226Ra) has had a number of uses. In the early 20th century, when the hazards of radiation were not well-known, radium was commonly used in consumer items such as toothpaste and hair creams. Radium was also formerly used as a radiation source for cancer treatment, but has since been replaced in this role by safer and more easily available alternatives. Until the 1960s, radium was used in luminous paint for watch dials and aircraft instruments.
== Description == The cap is 1.5–4 centimetres (1⁄2–1+1⁄2 in) across, dry, at first hemispheric, expanding to campanulate or convex, with an incurved margin when young. Young caps start out light brown and fade to off-white or light gray at maturity, sometimes with yellowish or brownish tones. Often developing cracks in dry weather, slightly hygrophanous, turning greenish or blue where damaged. The gills are broadly adnate to adnexed, close, starting out gray and turning black as the spores mature. The gill faces have a mottled appearance and the edges are white. The spore print is black. The stipe is 6–12 cm long by 2 to 4 mm thick, equal to slightly enlarged at the base, pruinose, colored like the cap, staining somewhat blue where bruised. The taste and odor are farinaceous.
With the purchase of the company in 2010, 3G began a program to restructure its menu designed to move away from the male-oriented menu that had dominated under the previous ownership. The first major item to be introduced was a reformulation of its BK Chicken Tenders product in March 2011. Over the next few months, approximately 20 new products were developed while others were reformulated, including its Chef's Choice Burger. Eventually pruned down to 10 items, Burger King began deploying the items in the United States throughout 2011–2012 with the official roll out beginning April 2012. The changes included new soft serve products, smoothies, frappés and chicken strips. The Whopper was the most prominently reformulated product in this round of introductions with a new type of cheese and packaging. At the end of 2015, Burger King's parent company, Restaurant Brands International, announced that none of its subsidiaries would use chicken that had been fed antibiotics that are "critically important" to human health; that announcement referred only to a small class of antibiotics for which there is only one drug that kill a kind of bacteria and the announcement was described as a "small step" by advocates for stopping all antibiotic use in livestock. In 2019, Burger King released an "Impossible Whopper" burger, a vegetarian burger using a plant-based patty from Impossible Foods. In February 2020, Burger King announced that it would remove artificial preservatives, colors, and flavors from the Whopper by the end of 2020.
== Prognosis == Symptoms of fibromyalgia are regarded as persistent in nearly all patients. The German Federal Ministry of Health guidance on FM refers to a longitudinal study (n = 1555) in which 10% of patients had substantial improvement in pain, 15% had moderate improvement, and 39% worsened. FM severity worsened in 36%. No average meaningful change in symptoms was found, and high levels of self-reported symptoms and distress continued for most patients. Fibromyalgia can cause substantial disability, with impacts on the ability to work, engage in recreational activities, and do household duties. Amongst people with fibromyalgia, the proportion that are able to maintain their jobs has been estimated at between 34% and 77%, and some research suggest the typical reduction in work hours is between 50-70%. There is variation in the level of impact, with 71.4% of those who are mild remaining in employment, compared to 61.2% of those who are moderate and 28.5% of those who are severe. Levels of pain can vary significantly over time, from severe pain to almost symptom-free phases. A 2023 meta-analysis found that FM people were at a standardized mortality ratio (i.e., observed mortality rates in the study population, compared to expected levels based on a standard population) of 3.37 (95% CI 1.52 to 7.50) for mortality due to suicide.
, depending on the convention used, measured in reciprocal poise (P−1, or cm·s·g−1), sometimes called the rhe. Fluidity is seldom used in engineering practice. At one time the petroleum industry relied on measuring kinematic viscosity by means of the Saybolt viscometer, and expressing kinematic viscosity in units of Saybolt universal seconds (SUS). Other abbreviations such as SSU (Saybolt seconds universal) or SUV (Saybolt universal viscosity) are sometimes used. Kinematic viscosity in centistokes can be converted from SUS according to the arithmetic and the reference table provided in ASTM D 2161.
Sources: en.wikipedia.org
ambassador to Israel Matt Gonzalez (1987), Green Party San Francisco mayoral candidate and independent 2008 candidate for vice president running with Ralph Nader Tim Kelly (1989), 74th mayor of Chattanooga, Tennessee Julie Menin (1989), former chairperson of Manhattan Community Board 1 and former commissioner of the New York City Department of Consumer Affairs Dave Hunt (1990), 65th speaker of the Oregon House of Representatives and majority leader 2007–2009 Michael Leiter (1991), principal deputy director of the National Counterterrorism Center; former deputy chief of staff for the Office of the Director of National Intelligence Melissa Mark-Viverito (1991), speaker of the New York City Council Benjamin Lawsky (1992), attorney and New York City's first superintendent of financial services Peter Hatch (1992), commissioner of the New York City Department of Consumer and Worker Protection Eric Garcetti (1992), member of the Los Angeles City Council and current mayor of Los Angeles, nominee to be U.S. ambassador to India Rohit Aggarwala (1993), commissioner of the New York City Department of Environmental Protection Matt Brown (1993), secretary of state of Rhode Island 2003–2007; co-founder of non-partisan group Global Zero Alan D.
=== 1990s === In 1992, the company acquired, then merged with, the Adelaide pathology practice Clinpath Laboratories. In 1994, Sonic Healthcare acquired and merged with Sydney's Tan Pathology. In 1995, Sonic Healthcare acquired the Adelaide practice Pathlab making it part of Clinpath Laboratories. The company also formally changed from Sonic Technology to Sonic Healthcare Limited. In 1996, Sonic Healthcare acquired New South Wales-based companies Hanly Moir Pathology and Barratt and Smith Pathologists, and Canberra-based Barratt Smith Moran Pathology. Douglass Laboratories merged operations with Hanly Moir Pathology to form Douglass Hanly Moir Pathology. Sonic Clinical Trials began operating from the Douglass Hanly Moir Pathology site at North Ryde. Sonic Healthcare became Australia's largest pathology group. In 1998, it acquired the SGS Medical Group: Sullivan Nicolaides Pathology (Queensland), Northern Pathology (Queensland), Melbourne Pathology (Victoria), Diagnostic Services (Tasmania), Diagnostic Medical Laboratories (New Zealand), Medlab Central (New Zealand), Medlab South (New Zealand), Valley Diagnostic Laboratories (New Zealand), and the New Zealand Radiology Group. This created the largest diagnostic group in Australasia and began the company's diagnostic imaging. In January 1999, Sonic Healthcare acquired two pathology operations from Alpha Healthcare: Australian Diagnostics Laboratories in Sydney and Southern Pathology on the south coast of New South Wales (NSW).
== Prevention == Opioid overdoses can often be prevented. Clear protocols for staff at emergency departments and urgent care centers can reduce opioid prescriptions for individuals presenting in these settings who engage in drug seeking behaviors or who have a history of a substance use disorder. Drug seeking behaviors include but are not limited to obsessiveness or impatience when it comes to attaining medications, seeking multiple pain adjunct medications, and inconsistent physiological presentation. A prescription monitoring program may help determine if an individual is receiving a high doses of opioids or combinations of medications such as benzodiazepines and opioids that put them at high risk. Limited amount of evidence suggests opioid therapy with extended-release or long-acting formulations may increase the risk of an unintentional overdose compared to shorter-acting agents. Routinely screening using tools such as the CAGE-AID and the Drug Abuse Screening Test (DAST-10) in adults and the CRAFFT in those aged 14–18 years is recommended. The revised risk index for overdose or severe opioid induced respiratory depression (RIOSORD) is a validated screening tool that may be used to estimate the risk of overdose in people using opioids, or the rapid opioid dependence screen may be used as a more rapid and succinct method to screen for opioid use disorder. Other "drug seeking" behaviors and physical indications of drug use should be used as clues to perform formal screenings.
== Adverse effects == Common side effects include infusion-related reactions, swelling caused by excess fluid in body tissue (edema), nausea, fatigue, headache, fever (pyrexia), constipation, anemia and diarrhea. The prescribing information for moxetumomab pasudotox includes a boxed warning about the risk of developing capillary leak syndrome, a condition in which fluid and proteins leak out of tiny blood vessels into surrounding tissues. Symptoms of capillary leak syndrome include difficulty breathing, weight gain, hypotension, or swelling of arms, legs and/or face. The boxed warning also notes the risk of hemolytic uremic syndrome, a condition caused by the abnormal destruction of red blood cells. Other serious warnings include: decreased renal function, infusion-related reactions and electrolyte abnormalities. Women who are breastfeeding should not be given moxetumomab pasudotox.
Sources: en.wikipedia.org
The dry powder is normally kept at -20 °C, protected from light and moisture. Reconstituted solutions are often divided into aliquots and stored at -80 °C to reduce freeze-thaw damage.
Reverse-phase HPLC assesses purity, and mass spectrometry confirms molecular mass. The combination helps distinguish the target peptide from truncated or modified impurities.
Buffer composition, pH, adsorption to containers, and freeze-thaw history can all affect the amount of intact peptide in solution. These factors may change results even when the starting material is chemically correct.
Dry lyophilized powder is usually kept frozen, desiccated, and out of direct light. Sealed vials are not opened until needed, because moisture uptake can degrade short peptides. Longer archival storage is often done at lower temperatures than routine working stock.