A practical reference on thymosin beta-4 fragment: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2025-12-25 and is reviewed periodically as new material appears.
Thymosin beta-4 is a naturally occurring protein of 43 amino acids found in most mammalian cells, where it binds actin monomers and influences filament dynamics. It was first isolated from thymus tissue in the early 1980s, and its actin-binding activity was later mapped to a short region near the N-terminus. The synthetic fragment sold as TB-500 was designed to reproduce that region rather than the full protein. Whether a short fragment reproduces the behavior of the intact molecule remains an open question, since the parent protein carries additional structural elements outside the binding region.
Published research on the intact protein is substantial, covering actin regulation, cell migration, and wound models. Research using the heptapeptide fragment specifically is far smaller, and much of the circulating material originates in supplier documentation rather than peer-reviewed reports. Where fragment studies do exist, they often employ different sequences, chain lengths, or terminal modifications, which complicates direct comparison across papers. Readers encountering claims about TB-500 should therefore separate evidence about thymosin beta-4 from evidence about the fragment itself.
Identity and purity are assessed with a small set of standard techniques. Reverse-phase high-performance liquid chromatography gives a purity estimate from peak area, usually recorded at 214 or 220 nanometers, where the peptide bond absorbs. Mass spectrometry confirms the expected molecular mass and can reveal truncated or oxidized species. Amino acid analysis or tandem mass spectrometry sequencing can verify the sequence itself. Additional quality attributes include water content, residual trifluoroacetic acid carried over from purification, and endotoxin where the material is intended for biological work.
The compound is most often distributed as a lyophilized powder, appearing white to off-white and forming a loose cake or fluffy solid. It is hygroscopic to some degree, so brief exposure to humid air can add water weight and complicate weighing. The peptide dissolves readily in water and in neutral aqueous buffers, and aqueous solubility is generally described as high, well above the concentrations used in typical assays. Some polar organic solvents are also usable, which matters when a concentrated stock is prepared before dilution into buffer.
| Property | Value | Notes |
|---|---|---|
| Reported sequence | Ac-LKKTETQ | Described in most listings as the actin-binding region of thymosin beta-4 |
| Reported molecular weight | Approximately 889 Da | Value shifts with the stated sequence; compare against the certificate of analysis |
| Parent protein length | 43 amino acids | Thymosin beta-4; the fragment covers only a small part of it |
| Common synonyms | TB4 fragment; thymosin beta-4 fragment | Trade-style names rather than formal nomenclature |
| Formal monographs | Not established | Labeling conventions differ by supplier and region |
Thymosin beta-4 is a 43-residue actin-binding protein found in most mammalian cell types, where it participates in cytoskeletal regulation and cell migration. TB-500 represents only a short fragment of that protein and does not include the remaining residues. Whether the isolated fragment reproduces the full range of activities reported for the intact protein remains an open question. Researchers commonly treat the two as related but distinct entities when comparing results.
Published work involving this sequence spans actin-binding assays, cell-migration studies, wound-healing models, and cardiovascular or musculoskeletal experiments. Much of the biological rationale derives from in vitro systems and animal models, and the number of controlled human studies is small. Reported outcomes vary across preparations, doses, and routes, which complicates comparison between studies. Reviews generally describe the evidence base as preliminary rather than settled. Mechanistic explanations are often proposed by analogy to the parent protein rather than demonstrated directly.
TB-500 is a synthetic seven-amino-acid peptide with the sequence LKKTETQ, corresponding to residues 17 through 23 of the protein thymosin beta-4. The N-terminus is typically acetylated in the described form, giving a monoisotopic mass near 888.5 Da and an average mass of about 889 Da. The designation TB-500 is a catalogue label rather than a formal chemical name, and the same sequence appears in the literature under several alternative abbreviations. It is handled as a research reagent rather than a pharmaceutical product.
Reconstitution of a lyophilized peptide is normally done with sterile water or a suitable buffer under aseptic conditions. Adding solvent down the vial wall and allowing gentle dissolution instead of vigorous vortexing reduces the chance of aggregation, which can lower the effective concentration of the resulting solution. Concentrated stocks are usually diluted into working buffer shortly before use. Because no standard preparation protocol exists for TB-500 specifically, laboratories adapt general peptide handling practice, and reported results may reflect differing preparation choices.
Dry peptide powder is commonly kept at −20 °C in a desiccated container away from light, a practice that limits moisture uptake and oxidation. Once dissolved, solutions are generally held at 2–8 °C for short periods or frozen at −20 °C or lower for longer storage, with repeated freeze-thaw cycles avoided. Hydrolysis and oxidation are the main degradation routes for peptides in solution, and both accelerate at higher temperature or extreme pH. Published stability data specific to TB-500 are limited, so shelf life should be treated as uncertain.
Research peptides are typically supplied as a white to off-white lyophilised powder in a sealed vial. The dry solid is more stable than a solution and is normally kept refrigerated or frozen until use. Dissolution is usually done in water, phosphate-buffered saline or a similar aqueous medium, depending on the assay. Because the material is hygroscopic and easily contaminated, opening vials in a low-humidity environment and recording the lot number before use are standard laboratory practices.
Once in solution, short peptides are generally less stable than the dry powder, and repeated freeze-thaw cycles are a common cause of loss. Laboratory guidance usually calls for aliquoting on first dissolution and storing aliquots at -20 °C or below, away from light. Adsorption to plastic and glass surfaces can lower measured concentration, particularly at low concentrations, so container material and buffer choice can affect results. Visible cloudiness, colour change or unexpected precipitate is a signal to re-check the material.
Purity is normally assessed by reversed-phase HPLC, with the main peak reported as a percentage of total peak area, while identity is confirmed by mass spectrometry. Electrospray and MALDI-TOF instruments are both used, and the observed mass is compared with the value calculated from the stated sequence. Ion-exchange or size-exclusion methods appear where aggregation or charge variants are of interest. Water content, counter-ion content and residual trifluoroacetate from purification are separate variables that can shift the measured mass and should be weighed when reading a certificate of analysis.
TB-500 refers to a synthetic peptide fragment derived from the actin-binding region of thymosin beta-4, a protein present in most mammalian cells. The full protein contains forty-three amino acids, while the commonly sold fragment is a much shorter acetylated sequence, often cited as LKKTETQ. The fragment retains part of the actin-binding motif but lacks the remainder of the parent protein. Material sold under this name is usually lyophilized powder intended for laboratory research, and it is not a finished pharmaceutical product.
Proposed activity centers on actin sequestration and on the movement of cells during repair processes. In cell culture and animal models, the fragment has been associated with migration, tube formation, and tissue remodeling. These observations are frequently described as preliminary, because most published work uses rodent or in vitro systems rather than controlled human trials. Whether the short fragment reproduces the effects of the full protein remains an open question, and the relationship between dose, route, and measured outcome is not well characterized.
== Functions == ATP is derived from ribose; it contains one ribose, three phosphate groups, and an adenine base. ATP is created during cellular respiration from adenosine diphosphate (ATP with one less phosphate group).
It is a very specific tag that can be used for purification of membrane proteins. S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS) SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Softag 1, for mammalian expression (SLAELLNAGLGGS) Softag 3, for prokaryotic expression (TQDPSRVG) Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK) T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC) Ty tag (EVHTNQDPLD) V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST) VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK) Xpress tag (DLYDDDDK), a peptide recognized by an antibody
=== Background === Uranium, element 92, is the heaviest element to occur in significant quantities in nature; heavier elements can only be practically produced by synthesis. The first synthesis of a new element—neptunium, element 93—was achieved in 1940 by a team of researchers in the United States. In the following years, American scientists synthesized the elements up to mendelevium, element 101, which was synthesized in 1955. From element 102, the priority of discoveries was contested between American and Soviet physicists. Their rivalry resulted in a race for new elements and credit for their discoveries, later named the Transfermium Wars.
=== Legal basis in Austria === The legal basis for radiation protection in Austria is the Radiation Protection Act (BGBl. 277/69 as amended) of June 11, 1969. The tasks of radiation protection extend to the fields of medicine, commerce and industry, research, schools, worker protection and food. The General Radiation Protection Ordinance, Federal Law Gazette II No. 191/2006, has been in force since June 1, 2006. Based on the Radiation Protection Act, it regulates the handling of radiation sources and measures for protection against ionizing radiation. The Optical Radiation Ordinance (VOPST) is a detailed ordinance to the Occupational Safety and Health Act (ASchG). On August 1, 2020, a new radiation protection law came into force, which largely harmonized the radiation protection regulations for artificial radioactive substances and terrestrial natural radioactive substances. They are now enshrined in the General Radiation Protection Ordinance 2020. Companies that carry out activities with naturally occurring radioactive substances are now subject to the licensing or notification requirements pursuant to Sections 15 to 17 of the Radiation Protection Act 2020, unless an exemption provision pursuant to Sections 7 or 8 of the General Radiation Protection Ordinance 2020 applies. Cement production including maintenance of clinker kilns, production of primary iron and tin, lead and copper smelting are included in the scope. If a company falls within the scope of the General Radiation Protection Ordinance 2020, its owner must commission an officially authorized monitoring body.
Apothecia (fruiting bodies) are rare in Parmotrema perlatum. When present, they measure 4–8 mm across and are somewhat stalked and funnel-shaped with a brown, concave disc. The edges of these structures curl inward, becoming thick with soredia as they mature. Its spores are ellipsoid in shape and typically measure between 20 and 28 μm in length and 11 to 17 μm in width, with a wall thickness of 2–3 μm. Pycnidia, which are structures that produce asexual spores called conidia, appear sporadically on the surface (laminal) of the thallus, with the conidia being thread-like and straight, measuring 6–8 by 1 μm.
Sources: en.wikipedia.org
==== Azerbaijan ==== According to research done by the University of Pennsylvania, there are a total of 12 think tanks in Azerbaijan. The Center for Economic and Social Development, or CESD; in Azeri, Azerbaijan, İqtisadi və Sosial İnkişaf Mərkəzi (İSİM) is an Azeri think tank, non-profit organization, NGO based in Baku, Azerbaijan. The center was established in 2005. CESD focuses on policy advocacy and reform, and is involved with policy research and capacity building. The Economic Research Center (ERC) is a policy-research oriented non-profit think tank established in 1999 with a mission to facilitate sustainable economic development and good governance in the new public management system of Azerbaijan. It seeks to do this by building favorable interactions between the public, private and civil society and working with different networks both in local (EITI NGO Coalition, National Budget Group, Public Coalition Against Poverty, etc.) and international levels (PWYP, IBP, ENTO, ALDA, PASOS, WTO NGO Network etc.). The Center for Strategic Studies under the President of Azerbaijan is a governmental, non-profit think tank founded in 2007. It focuses on domestic and foreign policy.
In the beginning of the 19th century the process of canning foods was mainly done by small canneries. These canneries were full of overlooked sanitation problems, such as poor hygiene and unsanitary work environments. Since the refrigerator did not exist and industrial canning standards were not set in place it was very common for contaminated cans to slip onto the grocery store shelves. According to The Fruits of Empire: Art, Food and the Politics of Race in the Age of American Expansion by Shana Klein, "Workers also suffered injuries, specifically bruised knuckles and open sores, from trimming and packaging pineapples. Gloves were one preventative measure to protect a canner's hands from the acidity of the pineapple, but gloves did not always help."
These ranged from deformed jaws to cyclopia. After decades of research, in the 1980s, the compound responsible for these deformities was identified as the alkaloid 11-deoxyjervine, later renamed to cyclopamine.
Their neighboring alpha cells, by taking their cues from the beta cells, secrete glucagon into the blood in the opposite manner: increased secretion when blood glucose is low, and decreased secretion when glucose concentrations are high. Glucagon increases blood glucose by stimulating glycogenolysis and gluconeogenesis in the liver. The secretion of insulin and glucagon into the blood in response to the blood glucose concentration is the primary mechanism of glucose homeostasis. Decreased or absent insulin activity results in diabetes, a condition of high blood sugar level (hyperglycaemia). There are two types of the disease. In type 1 diabetes, the beta cells are destroyed by an autoimmune reaction so that insulin can no longer be synthesized or be secreted into the blood. In type 2 diabetes, the destruction of beta cells is less pronounced than in type 1, and is not due to an autoimmune process. Instead, there is an accumulation of amyloid in the pancreatic islets, which likely disrupts their anatomy and physiology. The pathogenesis of type 2 diabetes is not well understood but reduced population of islet beta-cells, reduced secretory function of islet beta-cells that survive, and peripheral tissue insulin resistance are known to be involved. Type 2 diabetes is characterized by increased glucagon secretion which is unaffected by, and unresponsive to the concentration of blood glucose. However, insulin is still secreted into the blood in response to the blood glucose. As a result, glucose accumulates in the blood.
Sources: en.wikipedia.org
Most listings describe it as a short acetylated peptide with the sequence Ac-LKKTETQ, presented as a region of thymosin beta-4. The label is a trade-style name rather than a standardized chemical name, so the exact content of a given vial depends on the supplier.
No. Thymosin beta-4 is a protein of 43 amino acids, while TB-500 is described as a short fragment of it. The two differ in size, structure, and the range of interactions each can support.
Naming for research peptides is not centrally coordinated, so vendors set their own labels and specifications. Differences in stated sequence, molecular weight, or purity documentation usually trace back to those independent labeling choices.
Short transit at ambient temperature is generally tolerated, but long-term storage at room temperature is not recommended. Heat, moisture, and light all accelerate degradation. Cold, dry, dark storage is the conventional choice.